PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016432346.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 527aa    MW: 60359 Da    PI: 6.382
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016432346.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B351.61.7e-16119200590
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                     +++++ l+ g ++lp +fa+    ++ ++ +l+++de+ r W++kl+ + + +r+ +++GW++F  +n+LkegD +vF+++ ++e+
  XP_016432346.1 119 TIKPYCLTYGYMYLPQQFANGL--SN-KKCDLIIRDERQRLWNLKLS-SDCNNRVRIGDGWRKFIVDNRLKEGDHIVFEVVTDEET 200
                     578999999*********9444..43.3348***************5.66667799***********************8876544 PP

2B346.85.4e-15274355590
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                     +++++ l+ g l+l  +fa+    ++ ++ +l+++de+ r W++kl+ + +++r+ +++GW +F  +n+LkegD +vF+++ ++e+
  XP_016432346.1 274 TIKPYCLTYGYLYLAQQFANGL--SN-KKCDLIIRDERQRLWNLKLS-SDYKNRVRIGDGWCKFIADNRLKEGDRIVFEVVTDEET 355
                     578899999*********9444..43.3348***************5.777889*************************8876554 PP

3B354.22.7e-17408497597
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                     +++ ++ +++r+ +pk fa+e+g+++++  t+ ++d++ rs e++l y+ + g++++++ W++F+ an LkegD ++F+    +++++ +k++
  XP_016432346.1 408 TVKLHHISKCRMHVPKLFARENGLSNRK-CTIAIRDSEQRSLEFRL-YSSSAGSTFIGGEWRKFCAANFLKEGDCIMFEIFA-KGEKPILKFY 497
                     4578999***************999765.5****************.9999999*************************544.7777777766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019366.28E-18113205IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.4E-18113205IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.084115211IPR003340B3 DNA binding domain
CDDcd100172.06E-14115193No hitNo description
SMARTSM010193.1E-13116208IPR003340B3 DNA binding domain
PfamPF023627.4E-15119200IPR003340B3 DNA binding domain
SuperFamilySSF1019366.47E-15268360IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.2E-16268360IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.632270366IPR003340B3 DNA binding domain
CDDcd100172.23E-10270348No hitNo description
SMARTSM010191.1E-7271363IPR003340B3 DNA binding domain
PfamPF023621.6E-12274355IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.5E-16401495IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.47E-16404496IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.644404502IPR003340B3 DNA binding domain
SMARTSM010192.6E-9405500IPR003340B3 DNA binding domain
PfamPF023621.4E-15408497IPR003340B3 DNA binding domain
CDDcd100172.84E-15412498No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 527 aa     Download sequence    Send to blast
MLVFRYEGNM EFEVMIFDSS HCNREYAEYL QEEEAAATHT FGEASKNFEF EDTNNYASIP  60
SGDRLYQSSP STSCYLSHSR NTDDVIEIPS PGIKLSDEDS SRAEAATDKH VGHSHFVCTI  120
KPYCLTYGYM YLPQQFANGL SNKKCDLIIR DERQRLWNLK LSSDCNNRVR IGDGWRKFIV  180
DNRLKEGDHI VFEVVTDEET SIWKFHVVTT AETPMRKFQG GHGFEAWKQP LAEIPSPDDV  240
IEIPSPCIKS SDEDFSHAEA ATDKHVGHSH FVCTIKPYCL TYGYLYLAQQ FANGLSNKKC  300
DLIIRDERQR LWNLKLSSDY KNRVRIGDGW CKFIADNRLK EGDRIVFEVV TDEETSIWKF  360
HAVTNAETPM RKFQEKPEPN IMSSYKAFPD VEAAKDMPLS RPDHFISTVK LHHISKCRMH  420
VPKLFARENG LSNRKCTIAI RDSEQRSLEF RLYSSSAGST FIGGEWRKFC AANFLKEGDC  480
IMFEIFAKGE KPILKFYDLR ANASLHPEEA KPNLDAERVS TQGLGIG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016432346.10.0PREDICTED: B3 domain-containing protein REM17-like isoform X4
RefseqXP_016432345.10.0PREDICTED: B3 domain-containing protein REM17-like isoform X4
TrEMBLK4CIA91e-101K4CIA9_SOLLC; Uncharacterized protein
STRINGSolyc08g006200.1.11e-100(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26680.12e-22B3 family protein